PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091138.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HB-other
Protein Properties Length: 682aa    MW: 76435.4 Da    PI: 6.9588
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091138.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.32.3e-12656757
                    --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                     t+ qle+L  ++ +n+yp+  e+e+ A+ lgLt +qV+ WF  +R kek+
  XP_010091138.1  6 KTPRQLEALDPFYLENNYPTPVEMEDYAATLGLTYKQVRGWFVEKRRKEKR 56
                    5899**********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.6E-11161IPR001356Homeobox domain
SuperFamilySSF466895.56E-12557IPR009057Homeodomain-like
CDDcd000868.70E-12557No hitNo description
Gene3DG3DSA:1.10.10.605.6E-12556IPR009057Homeodomain-like
PfamPF000469.8E-10656IPR001356Homeobox domain
PROSITE profilePS5007113.572757IPR001356Homeobox domain
PROSITE profilePS5082712.079330389IPR018501DDT domain
SMARTSM005712.6E-7330389IPR018501DDT domain
PfamPF027914.1E-7333386IPR018501DDT domain
PfamPF156129.7E-7610642IPR028942WHIM1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MEIKRKTPRQ LEALDPFYLE NNYPTPVEME DYAATLGLTY KQVRGWFVEK RRKEKREGLA  60
TVPRTSSSKC KHNSKCKQML TVKNAVAKRK NKQSHLQDLF MPDYILRKVF RKDGPPLGLE  120
FDTLPSTRFF PCKGPGNSYP PCKENLRAIK RRKVSEHAVV STALNGKYPP VKKHGMGKGL  180
MTVWRITNPH AGDIPTGIDF ADEGTGASSI SKSVSRNPRI QLKKPQKQNI RNVELSEDGN  240
QELPDGQNCE LYLEGRDSQE SFHQISMLMD DEDLELGRLQ CVLDPPGCSG HSSTNAGLGC  300
SLCKDVLAKF PPNSVKMKQP FSTQPWESSV EIVKKLFKVF HFLYTYSLDV DICPFTLDEF  360
AQAFHDKDSL LLGKVNVALL KLLLSDIEEA HNNGSLPNLS RCCNYLALLH SVENQESVLE  420
FWKRSLNPLT WTEILRQVLV AAGFGSKQSA VRRESLDKEM HHMVTYGLRP GTLKGELFKI  480
LLEQGNNGLK VSDLAKSLPI VDLKIASTAE EVEYIICSVL SSDITLFEKI SSATYRLRIN  540
TIIKKAEEFQ SDTEDCGVVD DDLTGSDAYS SDEDSGCGSG SLSLQNWTIL KLRKSKEGIR  600
NVCTEIDESH SGEAWLLGLM EGEYSDLSIE EKLNAMVALT DLFRAGSSIG MEVMHRFFSF  660
FSIATNDLPH ISASMHQITL IQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146151RAIKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091138.10.0hypothetical protein L484_011346
SwissprotF4JRF51e-165RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLW9QMQ00.0W9QMQ0_9R
STRINGVIT_19s0085g00350.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61181519
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.11e-143Homeodomain-like transcriptional regulator